Books by agnes f. vandome

Refine Your Search

Books By agnes f. vandome : Showing 161 - 180 of 77029

Judenzahlung
by Agnes F. Vandome Frederic P. Miller John Mcbrewster

Price: Rs.3944
Delivered in 14-21 working days.
Language: English | Binding: Paperback

High Quality Content by WIKIPEDIA articles! Judenzählung (German for "Jewish census") was a measure instituted by the German Military High Command in October 1916, during the upheaval of World War I. Designed to confirm accusations of the lack of pat read more
Harry Holgate
by Agnes F. Vandome Frederic P. Miller John Mcbrewster

Price: Rs.3043
Delivered in 14-21 working days.
Language: English | Binding: Paperback

High Quality Content by WIKIPEDIA articles! The Hon. Harold Norman (Harry) Holgate, AO (5 December 1933 - 16 March 1997) was an Australian Labor Party politician and Premier of Tasmania from 11 November 1981 to 26 May 1982.Born in Maitland, New South Wale read more
Marquesan Language
by Agnes F. Vandome Frederic P. Miller John Mcbrewster

Price: Rs.2979
Delivered in 14-21 working days.
Language: English | Binding: Paperback

High Quality Content by WIKIPEDIA articles! Marquesan is a collection of East-Central Polynesian dialects, of the Marquesic group, spoken in the Marquesas Islands of French Polynesia. They are usually classified into two groups, North Marquesan and South read more
David Letterman Sketches
by Agnes F. Vandome Frederic P. Miller John Mcbrewster

Price: Rs.2864
Delivered in 14-21 working days.
Language: English | Binding: Paperback

High Quality Content by WIKIPEDIA articles CBS's Late Show with David Letterman regularly features different sketches that follow the monologue and precede interviews with guests. Often these are repeated absurdist segments, involving various cast members read more
The Late Late Show With Craig Ferguson
by Agnes F. Vandome Frederic P. Miller John Mcbrewster

Price: Rs.2979
Delivered in 14-21 working days.
Language: English | Binding: Paperback

High Quality Content by WIKIPEDIA articles! The Late Late Show with Craig Ferguson is a Peabody Award-winning American late-night talk show hosted by Scottish American comedian Craig Ferguson. Ferguson is the third regular host of the CBS Late Late Show f read more
Great Pacific Garbage Patch
by Agnes F. Vandome Frederic P. Miller John Mcbrewster

Price: Rs.3043
Delivered in 14-21 working days.
Language: English | Binding: Paperback

High Quality Content by WIKIPEDIA articles! The Great Pacific Garbage Patch, also described as the Pacific Trash Vortex is a gyre of marine litter in the central North Pacific Ocean located roughly between 135° to 155°W and 35° to 42°N. Al read more
Mesomedes
by Agnes F. Vandome Frederic P. Miller John Mcbrewster

Price: Rs.2796
Delivered in 14-21 working days.
Language: English | Binding: Paperback

High Quality Content by WIKIPEDIA articles! Mesomedes of Crete was a Greek lyric poet and composer of the early 2nd century. He was a freedman of the Emperor Hadrian, on whose favorite Antinous he is said to have written a panegyric, specifically called a read more
Amphilochius Of Iconium
by Agnes F. Vandome Frederic P. Miller John Mcbrewster

Price: Rs.2984
Delivered in 14-21 working days.
Language: English | Binding: Paperback

High Quality Content by WIKIPEDIA articles! Amphilochius of Iconium was a Christian bishop of the fourth century, son of a Cappadocian family of distinction, b. perhaps at Caesarea, ca. 339 or 340; d. probably some time between 394 and 403. His father was read more
Isolating Language
by Agnes F. Vandome Frederic P. Miller John Mcbrewster

Price: Rs.2805
Delivered in 14-21 working days.
Language: English | Binding: Paperback

High Quality Content by WIKIPEDIA articles! In morphological typology, an isolating language is any language in which words are composed of a single morpheme. This is in contrast to a synthetic language which can have words composed of multiple morphemes. read more
Mfsb
by Agnes F. Vandome Frederic P. Miller John Mcbrewster

Price: Rs.2807
Delivered in 14-21 working days.
Language: English | Binding: Paperback

High Quality Content by WIKIPEDIA articles! MFSB (short for "Mother Father Sister Brother") was a pool of more than thirty studio musicians based at Philadelphia's famed Sigma Sound Studios. They worked closely with the production team of Gamble and Huff read more
Mass Noun
by Agnes F. Vandome Frederic P. Miller John Mcbrewster

Price: Rs.2360
Delivered in 14-21 working days.
Language: English | Binding: Paperback

High Quality Content by WIKIPEDIA articles! In linguistics, a mass noun is a common noun that presents entities as an unbounded mass. Given that different languages have different grammatical resources, the actual test for which nouns are mass nouns may v read more
Liaison (French)
by Agnes F. Vandome Frederic P. Miller John Mcbrewster

Price: Rs.2354
Delivered in 14-21 working days.
Language: English | Binding: Paperback

High Quality Content by WIKIPEDIA articles! Liaison is the pronunciation of a latent word-final consonant immediately before a following vowel sound. In French, most written word-final consonants are no longer pronounced and are known as latent or mute. F read more
Cleft Sentence
by Agnes F. Vandome Frederic P. Miller John Mcbrewster

Price: Rs.2354
Delivered in 14-21 working days.
Language: English | Binding: Paperback

High Quality Content by WIKIPEDIA articles! A cleft sentence is a complex sentence which has a meaning that could be expressed by a simple sentence. Clefts typically put a particular constituent into focus. This focusing is often accompanied by a special read more
Mcw Metrobus
by Agnes F. Vandome Frederic P. Miller John Mcbrewster

Price: Rs.2796
Delivered in 14-21 working days.
Language: English | Binding: Paperback

High Quality Content by WIKIPEDIA articles! The MCW Metrobus is a double decker bus model manufactured by MCW (Metro Cammell Weymann) from 1977 until 1989, with over 4,000 examples built. The original MkI model was superseded by the MkII model (which h read more
Morphosyntactic Alignment
by Agnes F. Vandome Frederic P. Miller John Mcbrewster

Price: Rs.2541
Delivered in 14-21 working days.
Language: English | Binding: Paperback

High Quality Content by WIKIPEDIA articles! In linguistics, morphosyntactic alignment is the system used to distinguish between the arguments of transitive verbs and those of intransitive verbs. The distinction can be made morphologically, syntactically, read more
Aelia Flaccilla
by Agnes F. Vandome Frederic P. Miller John Mcbrewster

Price: Rs.2803
Delivered in 14-21 working days.
Language: English | Binding: Paperback

High Quality Content by WIKIPEDIA articles! Aelia Flavia Flaccilla (died 385), first wife of the Roman Emperor Theodosius I. She was of Hispanian Roman descent. During her marriage to Theodosius, she gave birth to two sons - future Emperors Arcadius an read more
Glucagon-Like Peptide-2
by Agnes F. Vandome Frederic P. Miller John Mcbrewster

Price: Rs.3430
Delivered in 14-21 working days.
Language: English | Binding: Paperback

High Quality Content by WIKIPEDIA articles! Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a read more
Marcellus Of Ancyra
by Agnes F. Vandome Frederic P. Miller John Mcbrewster

Price: Rs.3439
Delivered in 14-21 working days.
Language: English | Binding: Paperback

High Quality Content by WIKIPEDIA articles! Marcellus of Ancyra (? - c. 374 C.E.) was one of the bishops present at the Councils of Ancyra and of Nicaea. He was a strong opponent of Arianism, but was accused of adopting the opposite extreme of modified Sa read more
Gender Equity Education Act (Taiwan)
by Agnes F. Vandome Frederic P. Miller John Mcbrewster

Price: Rs.2796
Delivered in 14-21 working days.
Language: English | Binding: Paperback

High Quality Content by WIKIPEDIA articles! Gender Equity Education Act of Republic of China was announced on 2004 June. The General Provisions states the purposes of the act: "to promote substantive gender equality, eliminate gender discrimination, u read more
Lucius Aurelius Avianius Symmachus
by Agnes F. Vandome Frederic P. Miller John Mcbrewster

Price: Rs.2798
Delivered in 14-21 working days.
Language: English | Binding: Paperback

High Quality Content by WIKIPEDIA articles! Lucius Aurelius Avianius Symmachus signo Phosphorius (died in 376) was a politician of the Roman Empire, father of Quintus Aurelius Symmachus. A member of the aristocratic family of the Symmachi, he was the son read more